- SMARCD1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88719
- 0.1 ml (also 25ul)
- SMARCD1
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: MGPAPGQGLY RSPMPGAAYP RPGMLPGSRM TPQGPSMGPP GYGGNPSVRP GLAQSGMDQS RKRPAPQQIQ QVQQQAVQNR NHNAKK
- Unconjugated
- Human, Mouse, Rat
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- BAF60A, CRACD1, CSS11, Rsc6p
- SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Chromatin Research
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK
Specifications/Features
Available conjugates: Unconjugated